135082-FITC

UHRF1 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 1, Ubiquitin-like-containing PHD and RING Finger Domains Protein 1, hUHRF1, E3 Ubiquitin-protein Ligase UHRF1, Inverted CCAAT Box-binding Protein of 90kD, ICBP90, Nuclear Protein 95, NP95, Nuclear Zinc Finger Protein Np95, hNp95, HuNp95, RING Finger Protein 106, RNF106, Transcription Factor ICBP90) (FITC)

Größe

£914.00

SKU:: 135082-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa694-794 from human UHRF1 (NP_037414) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: Applications: Suitable for use in FLISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.