135082-BIOTIN

UHRF1 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 1, Ubiquitin-like-containing PHD and RING Finger Domains Protein 1, hUHRF1, E3 Ubiquitin-protein Ligase UHRF1, Inverted CCAAT Box-binding Protein of 90kD, ICBP90, Nuclear Protein 95, NP95, Nuclear Zinc Finger Protein Np95, hNp95, HuNp95, RING Finger Protein 106, RNF106, Transcription Factor ICBP90) (Biotin)

Größe

£914.00

SKU:: 135082-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa694-794 from human UHRF1 (NP_037414) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.