UGT1A6 (UDP-glucuronosyltransferase 1A6, UDP-glucuronosyltransferase 1-6, UDPGT 1-6, UGT1*6, UGT1-06, UGT1.6, UGT1, GNT1, Phenol-metabolizing UDP-glucuronosyltransferase, UDP-glucuronosyltransferase 1-F, UGT-1F, UGT1F)

Größe

£685.00

SKU:: 135070
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa44-144 from human UGT1A6 (NP_001063) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: DIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.