135070-ML650

UGT1A6 (UDP-glucuronosyltransferase 1A6, UDP-glucuronosyltransferase 1-6, UDPGT 1-6, UGT1*6, UGT1-06, UGT1.6, UGT1, GNT1, Phenol-metabolizing UDP-glucuronosyltransferase, UDP-glucuronosyltransferase 1-F, UGT-1F, UGT1F) (MaxLight 650)

Größe

£914.00

SKU:: 135070-ML650
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa44-144 from human UGT1A6 (NP_001063) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Weitere Details:: MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: FLISA: 0.1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: DIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.