135070-FITC

UGT1A6 (UDP-glucuronosyltransferase 1A6, UDP-glucuronosyltransferase 1-6, UDPGT 1-6, UGT1*6, UGT1-06, UGT1.6, UGT1, GNT1, Phenol-metabolizing UDP-glucuronosyltransferase, UDP-glucuronosyltransferase 1-F, UGT-1F, UGT1F) (FITC)

Größe

£914.00

SKU:: 135070-FITC
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa44-144 from human UGT1A6 (NP_001063) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: FLISA: 0.1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: DIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.