UGT1A3 (UDP-glucuronosyltransferase 1A3, UDP-glucuronosyltransferase 1-3, UDPGT 1-3, UGT1*3, UGT1-03, UGT1.3, UGT1, UDP-glucuronosyltransferase 1-C, UGT1C, UGT-1C, GNT1)

Größe

£685.00

SKU:: 135069
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa30-130 from human UGT1A3 (NP_061966) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.