UCP1 (Mitochondrial Brown Fat Uncoupling Protein 1, UCP 1, Solute Carrier Family 25 Member 7, Thermogenin, SLC25A7, UCP)

Größe

£685.00

SKU:: 135055
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa232-267 from human UCP1 (NP_068605) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.