UBE2L6 (Ubiquitin/ISG15-conjugating Enzyme E2 L6, Retinoic Acid-induced Gene B Protein, RIG-B, UbcH8, Ubiquitin Carrier Protein L6, Ubiquitin-protein Ligase L6) (Not for Export EU)

Größe

£760.00

SKU:: 135005
Reinheit:: Serum
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human UBE2L6, aa1-153 (NP_004214.1)
Format:: Supplied as a liquid.
Weitere Details:: Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.