134992-HRP

UBE2D3 (Ubiquitin-conjugating Enzyme E2 D3, UBC5C, UBCH5C, Ubiquitin Carrier Protein D3, Ubiquitin-conjugating Enzyme E2(17)KB 3, Ubiquitin-conjugating Enzyme E2-17kD 3, Ubiquitin-protein Ligase D3) (HRP)

Größe

£914.00

SKU:: 134992-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-147 from human UBE2D3 (AAH03395) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C1-1E3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.