UBE2D2 (Ubiquitin-conjugating Enzyme E2 D2, UBC4, UBC5B, UBCH4, UBCH5B, Ubiquitin Carrier Protein D2, Ubiquitin-conjugating Enzyme E2(17)KB 2, Ubiquitin-conjugating Enzyme E2-17kD 2, Ubiquitin-protein Ligase D2, p53-regulated Ubiquitin-conjugating Enzyme 1, PUBC1)

Größe

£685.00

SKU:: 134991
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-94 from human UBE2D2 (NP_003330) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.