UBASH3A (Ubiquitin-associated and SH3 Domain-containing Protein A, Cbl-interacting Protein 4, CLIP4, Suppressor of T-cell Receptor Signaling 2, STS2, STS-2, T-cell Ubiquitin Ligand 1, TULA-1, TULA)

Größe

£685.00

SKU:: 134977
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa524-624 from human UBASH3A (NP_001001895) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.