TYRO3 (Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase BYK, BYK, Tyrosine-protein Kinase DTK, DTK, Tyrosine-protein Kinase RSE, RSE, Tyrosine-protein Kinase SKY, SKY, Tyrosine-protein Kinase TIF, TIF)

Größe

£685.00

SKU:: 134957
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa50-150 from human TYRO3 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.