NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF)

Größe

£685.00

SKU:: 134946
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa81-191 from human TXNL6 (NP_612463) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7H3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NXNL1 may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.