TTC35 (EMC2, KIAA0103, ER Membrane Protein Complex Subunit 2, Tetratricopeptide Repeat Domain 35)

Größe

£685.00

SKU:: 134857
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human KIAA0103, aa1-297 (NP_055488).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: TTC35 is also known as TPR repeat protein 35. TPR domains consist of a variable number of degenerate tandem 34 amino acid repeats. TPR domains have been suggested to have a variety of functions in proteins in various subcellular compartments and appear to function as targeting domains, mediating specific protein-protein interactions. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.