TSGA2 (Testis-specific Gene A2 Protein, TSA2, Radial Spoke Head 1 Homolog, RSPH1, Cancer/testis Antigen 79, CT79, Male Meiotic Metaphase Chromosome-associated Acidic Protein, Meichroacidin, RSP44, RSPH10A)

Größe

£685.00

SKU:: 134813
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa200-310 from human TSGA2 (NP_543136) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.