134803-HRP
TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) (HRP)
Größe
£914.00
- SKU:
- 134803-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-97 from human TSC22D3 (NP_932174) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- The DSIPI protein has homology to porcine DIP (DSIP-immunoreactive peptide). The DSIPI protein contains a highly conserved leucine zipper region and belongs to the TSC-22/DIP/BUN family of transcriptional regulators. DSIPI is postulated to also function as a transcriptional regulator. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice