134799-ML550
TSC22D1 (TSC22 Domain Family Protein 1, Cerebral Protein 2, hucep-2, KIAA1994, MGC17597, Regulatory Protein TSC-22, TGFB-stimulated Clone 22 Homolog, Transforming Growth Factor beta-1-induced Transcript 4 Protein, TGFB1I4, TSC22, DKFZp686O19206, MGC17597, RP11-269C23.2) (MaxLight 550)
Größe
£914.00
- SKU:
- 134799-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-145 from TSC22D1 (AAH00456) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1G7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. TSC22 domain family protein, or TSC22, is a transcription factor that belongs to the large family of early response genes. This transcriptional repressor is known to act on the C-type natriuretic peptide (CNP) promoter. TSC22 belongs to the TSC-22:Dip:Bun family and is an intracellular protein that may be found in the cytoplasm or nucleus. This transcription factor is known to regulate cell growth, differentiation and cell death and is involved in modulating the transcriptional activity of Smad3 and Smad4. This protein is ubiquitously expressed in most tissues and widely in both fetal and adult tissues. It is generally expressed in aortic endothelial cells, and induced by cytokines, including TGFB. These proteins may be possible therapeutic targets of leukemia and prostate cancer. Applications: Suitable for use in FLISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice