TRIM68 (E3 Ubiquitin-protein Ligase TRIM68, RING Finger Protein 137, SSA Protein SS-56, SS-56, Tripartite Motif-containing Protein 68, GC109, RNF137, SS56)

Größe

£685.00

SKU:: 134767
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa181-281 form human TRIM68 (NP_060543) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5G2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Functions as an ubiquitin E3 ligase. Acts as a coactivator of androgen receptor (AR) depending on its ubiquitin ligase activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KQSIVWEFEKYQRLLEKKQPPHRQLGAEVAAALASLQREAAETMQKLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.