TRIM47 (Tripartite Motif-containing Protein 47, Gene Overexpressed in Astrocytoma Protein, RING Finger Protein 100, GOA, RNF100)

Größe

£685.00

SKU:: 134753
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa539-639 from human TRIM47 (NP_258411) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: TRIM47 belongs to the TRIM/RBCC family. It contains one B box type zinc finger, one B30.2/SPRY domain and one RING type zinc finger. TRIM47 has low expression in most tissues; higher expression in kidney tubular cells and over expressed in astrocytoma tumor cells. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.