134753-FITC
TRIM47 (Tripartite Motif-containing Protein 47, Gene Overexpressed in Astrocytoma Protein, RING Finger Protein 100, GOA, RNF100) (FITC)
Größe
£914.00
- SKU:
- 134753-FITC
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa539-639 from human TRIM47 (NP_258411) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3C8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- TRIM47 belongs to the TRIM/RBCC family. It contains one B box type zinc finger, one B30.2/SPRY domain and one RING type zinc finger. TRIM47 has low expression in most tissues; higher expression in kidney tubular cells and over expressed in astrocytoma tumor cells. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice