134743-P

TRIM33, Recombinant, Human, GSt Tag (E3 Ubiquitin-protein Ligase TRIM33, Ectodermin Homolog, RET-fused Gene 7 Protein, Protein Rfg7, Transcription Intermediary Factor 1-gamma, TIF1-gamma, Tripartite Motif-containing Protein 33, KIAA1113, RFG7, TIF1G)

Größe

£800.00

SKU:: 134743-P
Molekulargewicht:: 36.74
Reinheit:: Purified by Glutathione Sepharose affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer.
Weitere Details:: The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. Partial recombinant corresponding to aa1006-1105 from human TRIM33 with GST tag. MW of the GST-Tag alone is 26kD. Accession/Uniport: NM_015906, NP_056990 Amino Acid Sequence: VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing.. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.