Trefoil Factor 2 (TFF2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP)

Größe

£760.00

SKU:: 134699
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human TFF2, aa1-129 (NP_005414.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Human spasmolytic polypeptide (HSP) is a trefoil peptide found prominently in the foveolar and surface epithelium, pyloric glands and mucous neck cells of the stomach. This antibody will help detect HSP in normal and uncharacterized tissues. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.