TRAPPC4 (Trafficking Protein Particle Complex Subunit 4, Synbindin, TRS23 Homolog, Hematopoietic Stem/Progenitor Cell Protein 172, SBDN, CGI-104, HSPC172, PTD009)

Größe

£685.00

SKU:: 134694
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-220 from human TRAPPC4 (AAH10866) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: TRAPPC4 is part of the multisubunit TRAPP (transport protein particle) complex and interacts with SDC2. It may play a role in vesicular transport from endoplasmic reticulum to Golgi. TRAPP proteins are involved in tethering during vesicle transport. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.