TPTE (Transmembrane Phosphatase with Tensin Homology, Cancer/Testis Antigen 44, CT44, PTEN2, Putative Tyrosine Protein Phosphatase, Tumor Antigen BJ-HCC-5)

Größe

£685.00

SKU:: 134655
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa434-533 from human TPTE (NP_954868) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Could be involved in signal transduction. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.