TPT1 (Translationally-controlled tumor protein, TCTP, p23, Histamine-releasing Factor, HRF, Fortilin)

Größe

£685.00

SKU:: 134653
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa35-138 from human TPT1 (AAH22436) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C7
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: TPT1 is involved in calcium binding and microtubule stabilization. Applications: Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilutions: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.