134572
Troponin I, Cardiac (Troponin I Cardiac Muscle, Cardiac Troponin I, TNNC1, TNNI3, CMD1FF, CMD2A, CMH7, cTnI, RCM1)
Größe
£685.00
- SKU:
- 134572
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa 102-210 of human TNNI3 (NP_000354) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1E7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Applications: Suitable for use in ELISA, Western Blot, immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.7ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice