TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11, CD254, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, Receptor Activator of Nuclear Factor kappa-B Ligand, RANKL, TNF-related Activation-induced Cytokine, TRANCE)

Größe

£685.00

SKU:: 134549
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa222-317 from TNFSF11 (NP_003692) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDI* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.