TNFRSF19 (Tumor Necrosis Factor Receptor Superfamily Member 19, TRADE, Toxicity and JNK Inducer, TAJ, TROY, UNQ1888/PRO4333)

Größe

£685.00

SKU:: 134544
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa30-120 from human TNFRSF19 (NP_061117) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: TROY (also designated TAJ), a member of the TNFR superfamily, exists as several isoforms that vary in functions. Full length TROY contains a cytoplasmic tail, which recruits tumor necrosis factor receptor-associated factor (TRAF) 2. The interaction between TROY and TRAF2 promotes cell survival through the NFkB signaling pathway. One truncated version of TROY, designated TNFRSF19, contains a shortened cytoplasmic tail, which prevents TNFRSF19 from activating the NFkB signal transduction pathway. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.