134522
TMPRSS13 (Transmembrane Protease Serine 13, Membrane-type Mosaic Serine Protease, Mosaic Serine Protease, MSP, TMPRSS11, MSPL, MSPS)
Größe
£685.00
- SKU:
- 134522
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa182-280 from human TMPRSS13 (NP_114435) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4F7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLHRSECPSQRY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice