134441
TIE2 (Angiopoietin-1 Receptor, Endothelial Tyrosine Kinase, Tunica Interna Endothelial Cell Kinase, Tyrosine Kinase with Ig and EGF Homology Domains-2, Tyrosine-protein Kinase Receptor TEK, Tyrosine-protein Kinase Receptor TIE-2, hTIE2, p140 TEK, CD202b, TEK, VMCM, VMCM1)
Größe
£685.00
- SKU:
- 134441
- Reinheit:
- Purified by Protein A affinity chromatography
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa701-800 OF human TEK with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F8
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Weitere Details:
- The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice