ACOT11 (Acyl-coenzyme A Thioesterase 11, Acyl-CoA Thioesterase 11, Acyl-CoA Thioester Hydrolase 11, Adipose-associated Thioesterase, Brown Fat-inducible Thioesterase, BFIT, KIAA0707, THEA, THEM1, STARD14)

Größe

£685.00

SKU:: 134412
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from human THEA (AAH01517) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADGEGYRNPTEVQMSQLVLPCHTNQRGELSVGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFNSSMEVGIQVASEDLCSEKQWNVCK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.