134376
TG (Thyroglobulin)
Größe
£685.00
- SKU:
- 134376
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2659-2769 from human TG (NP_003226) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1G3
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Human Thyroglobulin (Tg) is a 660kD, dimeric protein produced by and used entirely within the thyroid gland. Human Thyroglobulin Tg was referred to as 'colloid'. Human Thyroglobulin (Tg) is used by the thyroid gland to produce the thyroid hormones thyroxine (T4) and triiodothyronine. Patients with Hashimoto's thyroiditis or Graves' disease, frequently develop antibodies against human Thyroglobulin (Tg). Human Thyroglobulin Tg-specific antibodies help in the diagnosis of these diseases, but they also may be present in apparently healthy euthyroid individuals. Human Thyroglobulin (Tg) levels in the blood can be used as a tumor marker for certain kinds of thyroid cancer. Thyroglobulin (Tg) levels in the blood can also be elevated in cases of Graves disease. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice