134363-FITC
TFCP2 (Alpha-globin Transcription Factor CP2, SAA3 Enhancer Factor, Transcription Factor LSF, LSF, SEF) (FITC)
Größe
£914.00
- SKU:
- 134363-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa414-503 from human TFCP2 (AAH03634) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3H6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- Transcription factor LSF (late simian virus 40 factor) also known as transcription factor LSF, CP2, LBP-1c, and SEF is expressed in a variety of cell types including brain, ovary, kidney, thymus, spleen, liver, adrenal, heart and lung. LSF is essential for cell cycle progression at the G1/S transition after reentry into the cell cycle from G0. LSF plays an important role in DNA synthesis and cell survival. A major cellular target of LSF is the thymidylate synthase (TS) gene coding for the rate limiting enzyme in the production of dTTP. Disruption of LSF function results in apoptosis at S phase or to cell cycle arrest at the G1/S transition. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMKAETNDSYHIILK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice