134332
TENM1 (ODZ1, Teneurin-1, Ten-1, Protein Odd Oz/Ten-m Homolog 1, Tenascin-M1, Ten-m1, Teneurin Transmembrane Protein 1, TNM1)
Größe
£685.00
- SKU:
- 134332
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2616-2725 from human ODZ1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G8
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Teneurin-1 may function as a cellular signal transducer. It exists as a disulfide-linked homodimer transmembrane protein. It is expressed in fetal brain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice