134331-FITC

Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin) (FITC)

Größe

£914.00

SKU:: 134331-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa181-290 from human TNC (NP_002151) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: Tenascin is a hexameric extracellular matrix protein. Tenascin may have a role in guiding migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. In the embryo, Tenascin is found in developing epithelia, cartilage and bone. In the adult, Tenascin is found in smooth muscle, tendon and hyper-proliferative skin. At least 6 isoforms of human Tenascin are produced by alternative splicing. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~10ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice