134313-APC

TDO (TPH2, TRPO, TDO2, Typtophan 2,3-dioxygenase, Tryptophanase, Typtophan Oxygenase, Tryptophan Pyrrolase, TO) (APC)

Größe

£927.00

SKU:: 134313-APC
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa307-405 from human TDO2 (NP_005642) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C8
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: TDO incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDES Storage and Stability: Store product at 4°C. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Allophycocyanin (APC) is light sensitive. Note: Applications are based on unconjugated antibody.