134295
TCF7 (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1, MGC129647, MGC129648)
Größe
£760.00
- SKU:
- 134295
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human TCF7, aa1-384 (NP_003193.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- The T cell specific transcription factor TCF7 activates genes involved in immune regulation and thymocyte differentiation, and is a candidate locus for genetic susceptibility to type 1 diabetes. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice