TBX18 (T-box Transcription Factor TBX18, T-box Protein 18)

Größe

£685.00

SKU:: 134260
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa454-560 from TBX18 (XP_496819) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: TBX18 is a 607aa, 65kD protein that is a member of the T-box family of developmentally expressed transcription factors. It is developmentally expressed in the anterior portion of the head, somites and limb buds. It is expressed on pluripotent progenitors in the developing epicardium where it is required for formation of the cardiac AV node, and can also contribute to fibroblast and smooth muscle formation. Within the region used as an immunogen, human TBX18 shares 93% aa identity with mouse and rat TBX18. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.