TAP1 (Antigen Peptide Transporter 1, APT1, Peptide Transporter TAP1, ATP-Binding Cassette Sub-family B Member 2, Peptide Supply Factor 1, Peptide Transporter PSF1, PSF-1, Peptide Transporter Involved In Antigen Processing 1, Really Interesting New Gene 4 Protein, ABCB2, PSF1, RING4, Y3, FLJ26666, FLJ41500)

Größe

£685.00

SKU:: 134215
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa241-350 from human TAP1 (AAH14081) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: PSF1 is a member of the GINS complex (PSF1, PSF2, PSF3 and SLD5) and regulates DNA replication in yeast. In mammals, PSF1 is essential for acute proliferation of stem cells in a variety of tissues. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.