134203-FITC
TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha, SM22-alpha, SM22, WS3-10, DKFZp686P11128) (FITC)
Größe
£914.00
- SKU:
- 134203-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-202 from human TAGLN (AAH04927) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1E2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- TAGLN (Transgelin), otherwise known as SM22-alpha, a shape change sensitive, actin cross-linking/gelling protein, and member of the calponin family, which plays a role in calcium interactions and contractile properties of the cell. TAGLN is ubiquitously expressed by vascular and visceral smooth muscle, and an early marker of smooth muscle differentiation, and also overexpressed by senescent human fibroblasts. Studies have identified TAGLN as a novel tumor suppressor protein, which has a markedly reduced expression in colorectal cancer samples, and may serve as an important biomarker of malignancy. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice