TAF7L (Transcription Initiation Factor TFIID Subunit 7-like, Cancer/Testis Antigen 40, CT40, RNA Polymerase II TBP-associated Factor Subunit Q, TATA Box-binding Protein-associated Factor 50kD, Transcription Initiation Factor TFIID 50kD Subunit, TAF2Q, FLJ23157, DJ738A13.1)

Größe

£685.00

SKU:: 134197
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa231-333 from human TAF7L (NP_079161) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. The encoded protein could be a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.