TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF(II)210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910)

Größe

£685.00

SKU:: 134188
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1532-1642 from human TAF1L (NP_722516) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May act as a functional substitute for TAF1/TAFII250 during male meiosis, when sex chromosomes are transcriptionally silenced. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.