TAF1A (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit A, RNA Polymerase I-specific TBP-associated Factor 48kD, TATA Box-binding Protein-associated Factor 1A, Transcription Factor SL1, Transcription Initiation Factor SL1/TIF-IB Subunit A)

Größe

£685.00

SKU:: 134182
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from TAF1A (NP_005672) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the smallest SL1-specific TAF. Two transcripts encoding different isoforms have been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.