134170-BIOTIN

TAF1 (Transcription Initiation Factor TFIID Subunit 1, Cell Cycle Gene 1 Protein, TBP-associated Factor 250kD, p250, Transcription Initiation Factor TFIID 250kD Subunit, TAF(II)250, TAFII-250, TAFII250, BA2R, CCG1, CCGS, TAF2A) (Biotin)

Größe

£914.00

SKU:: 134170-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1784-1894 from human TAF1 (NP_004597) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: BTAF1 regulates transcription in association with TATA binding protein (TBP). It removes TBP from the TATA box in an ATP-dependent manner. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.