134166-FITC
Tachykinin Receptor 1 (TAC1R, TACR1, NK-1 Receptor, NK1R, NK-1R, NKIR, Substance-P Receptor, SPR) (FITC)
Größe
£914.00
- SKU:
- 134166-FITC
- Anwendung:
- FLISA
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa140-244 from human TACR1 (NP_001049) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- Tachykinin Receptor 1, a member of the Tachykinin Receptor subfamily, is involved in the mediation of phosphatidylinositol metabolism by the tachykinin substance P, also referred to as neurokinin 1. It is associated with the management of depression, anxiety, and stress. It is also involved in regulating behavioral responses, neuronal survival, and cardiovascular and respiratory functions. The tachykinin receptor 1 is implicated in the progression of rheumatoid arthritis and osteoarthritis. Two variants of the tachykinin receptor 1 are produced by alternative splicing. Tachykinin receptor 1 has been reported primarily in brain, and in blood lymphocytes, nose, small intestine, and stomach. ESTs have been isolated from brain and spleen libraries. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice