134160-BIOTIN
TAB1 (TGF-beta-activated Kinase 1 and MAP3K7-binding Protein 1, Mitogen-activated Protein Kinase Kinase Kinase 7-interacting Protein 1, TGF-beta-activated Kinase 1-binding Protein 1, TAK1-binding Protein 1, MAP3K7IP1) (Biotin)
Größe
£914.00
- SKU:
- 134160-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa3-100 from MAP3K7IP1 (NP_705717) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2A12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- TAB1 (TAK1 binding protein 1) is an adaptor protein that can activate TAK1 in vivo through phosphorylation of TAK1, a mitogen-activated protein kinase kinase kinase. Once activated TAK1 phosphorylates MAPK kinase MKK4 and MKK3/6, which activate p38 MAPK and JNK, respectively. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice