134147-PE
SYP (Synaptophysin, Major Synaptic Vesicle Protein p38) (PE)
Größe
£914.00
- SKU:
- 134147-PE
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-314 from human SYP (AAH64550) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- Synaptophysin (p38) is an abundant integral membrane protein of small synaptic vesicles in the brain. It is also present in endocrine cells, where it is associated with small electron-translucent vesicles. Synaptophysin expression has been widely used as a marker for synaptogenesis in developmental studies in vivo and in vitro and as a marker for neuron-specific cell lineages in tumors of the central nervous system and of peripheral neuroendocrine cell derivation. It has multiple transmembrane regions and a cytoplasmic tail that contains 10 copies of a tyrosine-rich repeat. Biochemical experiments have demonstrated that it transverses the membrane four times and has cytoplasmic carboxyl- and amino-termini. It also contain unstable intramolecular disulfide bonds that spontaneously rearrange, thereby creating higher-order polymers that are larger than the native protein and that have distinctly different biochemical properties. Mutations involving the synaptophysin gene may be responsible for an X-linked disorder. Chromosomal localization of the human gene for synaptophysin established the human SYP locus on the X chromosome in subbands Xpll.22-pll.23. It is involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice