Synapsin I (Synapsin 1, Synapsin-1, SYN1, SYN-1, Synapsin-I, SYNI, SYN-I, Brain Protein 4.1)

Größe

£685.00

SKU:: 134131
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa362-451 from human SYN1 (NP_008881) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Synapsins are abundant brain proteins essential for regulating neurotransmitter release. All synapsins contain a short N-terminal domain that is highly conserved and phosphorylated by PKA or CaM kinase I. Phosphorylation of synapsin N-terminal domain at Ser9 inhibits its binding to phospholipids and diassociates synapsins from synaptic vesicles. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.