SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2)

Größe

£685.00

SKU:: 134091
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-96 from human SUMO2 (AAH08450) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2H8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Sentrin-2 also known as SUMO-3 is a novel ubiquitin-like protein that can be conjugated to other proteins in a manner analogous to ubiquitination. It is a 95aa peptide that is 46% identical and 66% homologous to sentrin-1. Sentrin interacts with the death domains of Fas, TNFR1 (tumor necrosis factor receptor 1), PML (a tumor suppressor), Rad51 and Rad 52, which are involved in repairing dsDNA breaks, and with GAP1. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.