SUMO1 (Small Ubiquitin-related Modifier 1, SUMO-1, GAP-modifying Protein 1, GMP1, Sentrin, SMT3 Homolog 3, SMT3H3, Ubiquitin-homology Domain Protein PIC1, PIC1, Ubiquitin-like Protein SMT3C, Smt3C, Ubiquitin-like Protein UBL1, UBL1)

Größe

£685.00

SKU:: 134089
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-101 from human SUMO1 (NP_001005781) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA, Immunofluorescence, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.